PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 471aa    MW: 51818.2 Da    PI: 7.3244
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631920.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.31.2e-061049437
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                    r C+ ++++ + l+C+ ++  lC  C ++ H+       H
  XP_009631920.1 10 RPCDFCNQQIAVLYCRADSAKLCLFCDQHVHSAnalskkH 49
                    78***************************99544555555 PP

2zf-B_box18.44.4e-065293342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvvpl 42
                     ++C+++ ++++++ C +++  lC++C    H +  H+++p+
  XP_009631920.1 52 SQICDNCCSEPVSIRCATDNLVLCQECDWDAHGScaHDRTPV 93
                    579**************************99*5599998875 PP

3CCT64.14.2e-22423466144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a++RYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  XP_009631920.1 423 RGNAMQRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKAN 466
                     7789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.442754IPR000315B-box-type zinc finger
SMARTSM003368.0E-11754IPR000315B-box-type zinc finger
CDDcd000212.48E-71042No hitNo description
PROSITE profilePS501199.2295093IPR000315B-box-type zinc finger
CDDcd000214.58E-65493No hitNo description
PROSITE profilePS5101714.912423465IPR010402CCT domain
PfamPF062031.8E-16423465IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MSQRNTGDSR PCDFCNQQIA VLYCRADSAK LCLFCDQHVH SANALSKKHL RSQICDNCCS  60
EPVSIRCATD NLVLCQECDW DAHGSCAHDR TPVEGFSGCP CASELASAWG LDVEAKKPPT  120
PTHLQPTWNG FLEPCNWMCK DVIPPPSVLL QDLMVPNANN NSGIYSTTRE VGRKQNPTCG  180
KQKQVILKQL IELFKRDFAD GVGGGSEDLV PKTPNGSSDW QGNVNVTEGS DAVMGGANQQ  240
LEPQSVPFTS LLMMQKPHNS KDSDRMVQGN ILSSGNSYVQ NTQIWDFNLG QLRSHEQSSS  300
VEADYSESDM AYMMKSYGEL IKGTSLATSK GLELSGINCS VAHEDMTALS NNSNNRGGSQ  360
GPATSESNNL PIIKLSSDSG YTKRKCCGVS KDLNFMEQSI FVGGENTGEE ILKADMELLA  420
KNRGNAMQRY KEKKKTRRYD KHIRYESRKA RADTRKRVKG RFVKANEAPD G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754442e-76HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755172e-76HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631922.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631921.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631920.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631919.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0V0ID810.0A0A0V0ID81_SOLCH; Putative zinc finger protein CONSTANS-LIKE 15-like (Fragment)
STRINGPGSC0003DMT4000653770.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.18e-99B-box type zinc finger protein with CCT domain